Lineage for d2jizb1 (2jiz B:23-94)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067429Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)
  8. 2067434Domain d2jizb1: 2jiz B:23-94 [238707]
    Other proteins in same PDB: d2jiza2, d2jiza3, d2jizb2, d2jizb3, d2jizc2, d2jizc3, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh2, d2jizh3, d2jizi2, d2jizi3, d2jizj2, d2jizj3, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_
    automated match to d1maba2
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizb1

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jizb1 b.49.1.0 (B:23-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli
kegdivkrtgai

SCOPe Domain Coordinates for d2jizb1:

Click to download the PDB-style file with coordinates for d2jizb1.
(The format of our PDB-style files is described here.)

Timeline for d2jizb1: