Lineage for d2jebi2 (2jeb I:66-152)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (33 species)
    not a true protein
  7. 2052302Species Sulfolobus solfataricus [TaxId:2287] [188424] (3 PDB entries)
  8. 2052303Domain d2jebi2: 2jeb I:66-152 [238703]
    Other proteins in same PDB: d2jeba1, d2jeba2, d2jeba3, d2jebb1, d2jebb2, d2jebi1
    automated match to d2je6i1
    complexed with 1pe, cl, mn

Details for d2jebi2

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jebi2:

Sequence, based on SEQRES records: (download)

>d2jebi2 b.40.4.0 (I:66-152) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

Sequence, based on observed residues (ATOM records): (download)

>d2jebi2 b.40.4.0 (I:66-152) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfddpvlsvkgkdlgrvs

SCOPe Domain Coordinates for d2jebi2:

Click to download the PDB-style file with coordinates for d2jebi2.
(The format of our PDB-style files is described here.)

Timeline for d2jebi2: