SCOPe 2.08: Domain d2jebi1: 2jeb I:8-65

Lineage for d2jebi1 (2jeb I:8-65)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.0: automated matches [254239] (1 protein)
   not a true family

6. Protein automated matches [254547] (1 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255254] (2 PDB entries)

8. Domain d2jebi1: 2jeb I:8-65 [238702]
   Other proteins in same PDB: d2jeba1, d2jeba2, d2jeba3, d2jebb1, d2jebb2, d2jebi2
   automated match to d2je6i2
   complexed with 1pe, cl, mn

Details for d2jebi1

PDB Entry: 2jeb, 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions

PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jebi1:

Sequence; same for both SEQRES and ATOM records:

>d2jebi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

Timeline for d2jebi1:

• d2jebi1 first appeared in SCOPe 2.04
  
• d2jebi1 appears in SCOPe 2.07