Lineage for d2jebi1 (2jeb I:8-65)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817766Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2817837Family b.84.4.0: automated matches [254239] (1 protein)
    not a true family
  6. 2817838Protein automated matches [254547] (1 species)
    not a true protein
  7. 2817839Species Sulfolobus solfataricus [TaxId:2287] [255254] (2 PDB entries)
  8. 2817840Domain d2jebi1: 2jeb I:8-65 [238702]
    Other proteins in same PDB: d2jeba1, d2jeba2, d2jeba3, d2jebb1, d2jebb2, d2jebi2
    automated match to d2je6i2
    complexed with 1pe, cl, mn

Details for d2jebi1

PDB Entry: 2jeb (more details), 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jebi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jebi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

SCOPe Domain Coordinates for d2jebi1:

Click to download the PDB-style file with coordinates for d2jebi1.
(The format of our PDB-style files is described here.)

Timeline for d2jebi1: