SCOPe 2.06: Domain d1a8mc_: 1a8m C:

Lineage for d1a8mc_ (1a8m C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (19 PDB entries)

8. Domain d1a8mc_: 1a8m C: [23870]
   mutant

Details for d1a8mc_

PDB Entry: 1a8m, 2.3 Å

PDB Description: tumor necrosis factor alpha, r31d mutant

PDB Compounds: (C:) tumor necrosis factor alpha

SCOPe Domain Sequences for d1a8mc_:

Sequence; same for both SEQRES and ATOM records:

>d1a8mc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlndranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyldfaesgqvyfgiial

Timeline for d1a8mc_:

• d1a8mc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a8mc_ appears in SCOPe 2.05
  
• d1a8mc_ appears in SCOPe 2.07
  
• d1a8mc_ appears in the current release, SCOPe 2.08