Lineage for d2j5wa6 (2j5w A:193-338)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772520Domain d2j5wa6: 2j5w A:193-338 [238699]
    automated match to d1kcwa2
    complexed with ca, cu, gol, na, nag, o, oxy

Details for d2j5wa6

PDB Entry: 2j5w (more details), 2.8 Å

PDB Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d2j5wa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5wa6 b.6.1.0 (A:193-338) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqqsnrmysvngytfgsls
glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp
gewmlscqnlnhlkaglqaffqvqec

SCOPe Domain Coordinates for d2j5wa6:

Click to download the PDB-style file with coordinates for d2j5wa6.
(The format of our PDB-style files is described here.)

Timeline for d2j5wa6: