![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
![]() | Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) ![]() automatically mapped to Pfam PF02560 |
![]() | Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins) active form is a decamer formed by five dimers |
![]() | Protein automated matches [230795] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [230796] (6 PDB entries) |
![]() | Domain d2ivbh2: 2ivb H:87-156 [238691] Other proteins in same PDB: d2ivba1, d2ivbb1, d2ivbc1, d2ivbd1, d2ivbe1, d2ivbf1, d2ivbg1, d2ivbh1, d2ivbi1, d2ivbj1 automated match to d2ivbc2 complexed with azi, cl, so4 |
PDB Entry: 2ivb (more details), 1.95 Å
SCOPe Domain Sequences for d2ivbh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivbh2 d.72.1.1 (H:87-156) automated matches {Escherichia coli [TaxId: 562]} riptdptmyrfyemlqvygttlkalvhekfgdgiiaainfkldvkkvadpeggeravitl dgkylptkpf
Timeline for d2ivbh2: