Lineage for d1a8mb_ (1a8m B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777391Protein Tumor necrosis factor (TNF) [49848] (3 species)
  7. 2777392Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries)
  8. 2777428Domain d1a8mb_: 1a8m B: [23869]
    mutant

Details for d1a8mb_

PDB Entry: 1a8m (more details), 2.3 Å

PDB Description: tumor necrosis factor alpha, r31d mutant
PDB Compounds: (B:) tumor necrosis factor alpha

SCOPe Domain Sequences for d1a8mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8mb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlndranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d1a8mb_:

Click to download the PDB-style file with coordinates for d1a8mb_.
(The format of our PDB-style files is described here.)

Timeline for d1a8mb_: