SCOPe 2.04: Domain d2ivbg2: 2ivb G:87-156

Lineage for d2ivbg2 (2ivb G:87-156)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family)
   automatically mapped to Pfam PF02560

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
   active form is a decamer formed by five dimers

6. Protein automated matches [230795] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [230796] (6 PDB entries)

8. Domain d2ivbg2: 2ivb G:87-156 [238689]
   Other proteins in same PDB: d2ivba1, d2ivbb1, d2ivbc1, d2ivbd1, d2ivbe1, d2ivbf1, d2ivbg1, d2ivbh1, d2ivbi1, d2ivbj1
   automated match to d2ivbc2
   complexed with azi, cl, so4

Details for d2ivbg2

PDB Entry: 2ivb, 1.95 Å

PDB Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase

PDB Compounds: (G:) cyanate hydratase

SCOPe Domain Sequences for d2ivbg2:

Sequence; same for both SEQRES and ATOM records:

>d2ivbg2 d.72.1.1 (G:87-156) automated matches {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiiaainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d2ivbg2:

• d2ivbg2 is new in SCOPe 2.04-stable
  
• d2ivbg2 appears in SCOPe 2.05
  
• d2ivbg2 appears in the current release, SCOPe 2.08