Lineage for d2ioug_ (2iou G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069323Family b.80.1.7: Virulence factor P.69 pertactin [51153] (2 protein domains)
  6. 2069327Protein automated matches [254543] (1 species)
    not a true protein
  7. 2069328Species Bordetella bronchiseptica [TaxId:257310] [255242] (1 PDB entry)
  8. 2069329Domain d2ioug_: 2iou G: [238683]
    Other proteins in same PDB: d2ioua1, d2ioua2, d2ioub1, d2ioub2, d2iouc1, d2iouc2, d2ioud1, d2ioud2, d2ioue1, d2ioue2, d2iouf1, d2iouf2
    automated match to d1daba_
    complexed with mg

Details for d2ioug_

PDB Entry: 2iou (more details), 3.16 Å

PDB Description: major tropism determinant p1 (mtd-p1) variant complexed with bordetella brochiseptica virulence factor pertactin extracellular domain (prn-e).
PDB Compounds: (G:) Pertactin Extracellular Domain

SCOPe Domain Sequences for d2ioug_:

Sequence, based on SEQRES records: (download)

>d2ioug_ b.80.1.7 (G:) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
dwnnqsiikagerqhgihikqsdgagvrtatgttikvsgrqaqgvllenpaaelrfqngs
vtssgqlfdegvrrflgtvtvkagklvadhatlanvsdtrdddgialyvageqaqasiad
stlqgaggvrverganvtvqrstivdgglhigtlqplqpedlppsrvvlgdtsvtavpas
gapaavsvfganeltvdgghitggraagvaamdgaivhlqratirrgdapaggavpggav
pggavpggfgplldgwygvdvsdstvdlaqsiveapqlgaairagrgarvtvsggslsap
hgnvietgggarrfpppasplsitlqagaraqgrallyrvlpepvkltlaggaqgqgdiv
atelppipgassgpldvalasqarwtgatravdslsidnatwvmtdnsnvgalrlasdgs
vdfqqpaeagrfkvlmvdtlagsglfrmnvfadlglsdklvvmrdasgqhrlwvrnsgse
pasantmllvqtprgsaatftlankdgkvdigtyryrlaangngqwslvgakapp

Sequence, based on observed residues (ATOM records): (download)

>d2ioug_ b.80.1.7 (G:) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
dwnnqsiikagerqhgihikqsdgagvrtatgttikvsgrqaqgvllenpaaelrfqngs
vtssgqlfdegvrrflgtvtvkagklvadhatlanvsdtrdddgialyvageqaqasiad
stlqgaggvrverganvtvqrstivdgglhigtlqplqpedlppsrvvlgdtsvtavpas
gapaavsvfganeltvdgghitggraagvaamdgaivhlqratirrggwygvdvsdstvd
laqsiveapqlgaairagrgarvtvsggslsaphgnvietgggarrfpppasplsitlqa
garaqgrallyrvlpepvkltlaggaqgqgdivatelppipgassgpldvalasqarwtg
atravdslsidnatwvmtdnsnvgalrlasdgsvdfqqpaeagrfkvlmvdtlagsglfr
mnvfadlglsdklvvmrdasgqhrlwvrnsgsepasantmllvqtprgsaatftlankdg
kvdigtyryrlaangngqwslvgakapp

SCOPe Domain Coordinates for d2ioug_:

Click to download the PDB-style file with coordinates for d2ioug_.
(The format of our PDB-style files is described here.)

Timeline for d2ioug_: