Lineage for d1a8ma_ (1a8m A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.22: TNF-like [49841] (1 superfamily) Superfamily b.22.1: TNF-like [49842] (1 family) 
Family b.22.1.1: TNF-like [49843] (4 proteins) 
Protein Tumor necrosis factor (TNF) [49848] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries) 
Domain d1a8ma_: 1a8m A: [23868]
Details for d1a8ma_
PDB Entry: 1a8m (more details), 2.3 Å
PDB Description: tumor necrosis factor alpha, r31d mutant
SCOP Domain Sequences for d1a8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8ma_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
rtpsdkpvahvvanpqaegqlqwlndranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyldfaesgqvyfgiial
SCOP Domain Coordinates for d1a8ma_:
Click to download the PDB-style file with coordinates for d1a8ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8ma_:
- d1a8ma_ appears in SCOP 1.57
- d1a8ma_ appears in the current release, SCOPe 2.08
View in 3D
