| Class b: All beta proteins [48724] (180 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries) |
| Domain d2hldx1: 2hld X:7-82 [238677] Other proteins in same PDB: d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd2, d2hldd3, d2hlde2, d2hlde3, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm2, d2hldm3, d2hldn2, d2hldn3, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv2, d2hldv3, d2hldw2, d2hldw3, d2hldx2, d2hldx3, d2hldy_, d2hldz1 automated match to d2jdid2 complexed with anp, mg, po4 |
PDB Entry: 2hld (more details), 2.8 Å
SCOPe Domain Sequences for d2hldx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hldx1 b.49.1.1 (X:7-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
teglvrgekvldtggp
Timeline for d2hldx1:
View in 3DDomains from other chains: (mouse over for more information) d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldy_, d2hldz1 |