Lineage for d2hldv1 (2hld V:6-82)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1547882Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1548010Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1548011Protein automated matches [254527] (6 species)
    not a true protein
  7. 1548019Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1548032Domain d2hldv1: 2hld V:6-82 [238671]
    Other proteins in same PDB: d2hldd2, d2hldd3, d2hlde2, d2hlde3, d2hldf2, d2hldf3, d2hldg_, d2hldm2, d2hldm3, d2hldn2, d2hldn3, d2hldo2, d2hldo3, d2hldp_, d2hldv2, d2hldv3, d2hldw2, d2hldw3, d2hldx2, d2hldx3, d2hldy_
    automated match to d2jdid2
    complexed with anp, mg, po4

Details for d2hldv1

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (V:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldv1 b.49.1.0 (V:6-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

SCOPe Domain Coordinates for d2hldv1:

Click to download the PDB-style file with coordinates for d2hldv1.
(The format of our PDB-style files is described here.)

Timeline for d2hldv1: