Lineage for d2hldo3 (2hld O:358-474)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)
  8. 2717390Domain d2hldo3: 2hld O:358-474 [238670]
    Other proteins in same PDB: d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hlde1, d2hlde2, d2hldf1, d2hldf2, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldn1, d2hldn2, d2hldo1, d2hldo2, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldw1, d2hldw2, d2hldx1, d2hldx2, d2hldy_, d2hldz1
    automated match to d2jdid1
    complexed with anp, mg, po4

Details for d2hldo3

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (O:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldo3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldo3 a.69.1.1 (O:358-474) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla

SCOPe Domain Coordinates for d2hldo3:

Click to download the PDB-style file with coordinates for d2hldo3.
(The format of our PDB-style files is described here.)

Timeline for d2hldo3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1