Lineage for d1tnra_ (1tnr A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12261Fold b.22: TNF-like [49841] (1 superfamily)
  4. 12262Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 12263Family b.22.1.1: TNF-like [49843] (4 proteins)
  6. 12286Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 12287Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)
  8. 12295Domain d1tnra_: 1tnr A: [23867]
    Other proteins in same PDB: d1tnrr1, d1tnrr2, d1tnrr3

Details for d1tnra_

PDB Entry: 1tnr (more details), 2.85 Å

PDB Description: crystal structure of the soluble human 55 kd tnf receptor-human tnf- beta complex: implications for tnf receptor activation

SCOP Domain Sequences for d1tnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnra_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
kpaahligdpskqnsllwrantdraflqdgfslsnnsllvptsgiyfvysqvvfsgkays
pkatssplylahevqlfssqypfhvpllssqkmvypglqepwlhsmyhgaafqltqgdql
sthtdgiphlvlspstvffgafal

SCOP Domain Coordinates for d1tnra_:

Click to download the PDB-style file with coordinates for d1tnra_.
(The format of our PDB-style files is described here.)

Timeline for d1tnra_: