Lineage for d2hldo2 (2hld O:83-357)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596728Protein automated matches [190393] (9 species)
    not a true protein
  7. 1596733Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries)
  8. 1596745Domain d2hldo2: 2hld O:83-357 [238669]
    Other proteins in same PDB: d2hldd1, d2hldd3, d2hlde1, d2hlde3, d2hldf1, d2hldf3, d2hldg_, d2hldm1, d2hldm3, d2hldn1, d2hldn3, d2hldo1, d2hldo3, d2hldp_, d2hldv1, d2hldv3, d2hldw1, d2hldw3, d2hldx1, d2hldx3, d2hldy_
    automated match to d2jdid3
    complexed with anp, mg, po4

Details for d2hldo2

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (O:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldo2 c.37.1.11 (O:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d2hldo2:

Click to download the PDB-style file with coordinates for d2hldo2.
(The format of our PDB-style files is described here.)

Timeline for d2hldo2: