Lineage for d2hj6h2 (2hj6 H:36-251)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384684Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2384685Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2384686Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2384805Protein automated matches [226918] (3 species)
    not a true protein
  7. 2384811Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)
  8. 2384813Domain d2hj6h2: 2hj6 H:36-251 [238652]
    Other proteins in same PDB: d2hj6h1, d2hj6l_, d2hj6m_
    automated match to d2j8dh2
    complexed with bcl, bph, cdl, fe, gol, hto, k, lda, po4, ps2, u10

Details for d2hj6h2

PDB Entry: 2hj6 (more details), 3 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylserine
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2hj6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hj6h2 b.41.1.1 (H:36-251) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

SCOPe Domain Coordinates for d2hj6h2:

Click to download the PDB-style file with coordinates for d2hj6h2.
(The format of our PDB-style files is described here.)

Timeline for d2hj6h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hj6h1