SCOPe 2.08: Domain d2grmc2: 2grm C:67-294

Lineage for d2grmc2 (2grm C:67-294)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein automated matches [254479] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)

8. Domain d2grmc2: 2grm C:67-294 [238650]
   Other proteins in same PDB: d2grma1, d2grma2, d2grmb1, d2grmc1
   automated match to d2awia2

Details for d2grmc2

PDB Entry: 2grm, 3 Å

PDB Description: crystal structure of prgx/icf10 complex

PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2grmc2:

Sequence; same for both SEQRES and ATOM records:

>d2grmc2 a.118.8.4 (C:67-294) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingcydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppke

Timeline for d2grmc2:

• d2grmc2 first appeared in SCOPe 2.04
  
• d2grmc2 appears in SCOPe 2.07