SCOPe 2.06: Domain d5tswe_: 5tsw E:

Lineage for d5tswe_ (5tsw E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (19 PDB entries)

8. Domain d5tswe_: 5tsw E: [23865]
   mutant

Details for d5tswe_

PDB Entry: 5tsw, 2.5 Å

PDB Description: high resolution crystal structure of a human tnf-alpha mutant

PDB Compounds: (E:) protein (tumor necrosis factor-alpha)

SCOPe Domain Sequences for d5tswe_:

Sequence; same for both SEQRES and ATOM records:

>d5tswe_ b.22.1.1 (E:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
gdrlsaeinrpdyldfaesgqvyfgiial

Timeline for d5tswe_:

• d5tswe_ first appeared (with stable ids) in SCOP 1.55
  
• d5tswe_ appears in SCOPe 2.05
  
• d5tswe_ appears in SCOPe 2.07
  
• d5tswe_ appears in the current release, SCOPe 2.08