Lineage for d2grmc1 (2grm C:1-66)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1489279Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1489280Protein automated matches [190907] (7 species)
    not a true protein
  7. 1489332Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 1489343Domain d2grmc1: 2grm C:1-66 [238649]
    Other proteins in same PDB: d2grma1, d2grma2, d2grmb2, d2grmc2
    automated match to d2awia1

Details for d2grmc1

PDB Entry: 2grm (more details), 3 Å

PDB Description: crystal structure of prgx/icf10 complex
PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2grmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grmc1 a.35.1.0 (C:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

SCOPe Domain Coordinates for d2grmc1:

Click to download the PDB-style file with coordinates for d2grmc1.
(The format of our PDB-style files is described here.)

Timeline for d2grmc1: