Lineage for d2fjhl2 (2fjh L:107-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030185Domain d2fjhl2: 2fjh L:107-214 [238648]
    Other proteins in same PDB: d2fjha1, d2fjhl1, d2fjhv_, d2fjhw_
    automated match to d1dn0a2

Details for d2fjhl2

PDB Entry: 2fjh (more details), 3.1 Å

PDB Description: Structure of the B20-4 Fab, a phage derived Fab fragment, in complex with VEGF
PDB Compounds: (L:) Fab fragment light chain

SCOPe Domain Sequences for d2fjhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjhl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d2fjhl2:

Click to download the PDB-style file with coordinates for d2fjhl2.
(The format of our PDB-style files is described here.)

Timeline for d2fjhl2: