SCOPe 2.06: Domain d2fj8a2: 2fj8 A:4-64

Lineage for d2fj8a2 (2fj8 A:4-64)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein automated matches [192457] (4 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries)

8. Domain d2fj8a2: 2fj8 A:4-64 [238644]
   automated match to d1c2aa1

Details for d2fj8a2

PDB Entry: 2fj8, 1.19 Å

PDB Description: High resolution structure of barley Bowman-Birk inhibitor

PDB Compounds: (A:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d2fj8a2:

Sequence; same for both SEQRES and ATOM records:

>d2fj8a2 g.3.13.1 (A:4-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
krpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpic
r

Timeline for d2fj8a2:

• d2fj8a2 first appeared in SCOPe 2.04
  
• d2fj8a2 appears in SCOPe 2.05
  
• d2fj8a2 appears in SCOPe 2.07
  
• d2fj8a2 appears in the current release, SCOPe 2.08