![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein automated matches [192457] (3 species) not a true protein |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries) |
![]() | Domain d2fj8a2: 2fj8 A:4-64 [238644] automated match to d1c2aa1 |
PDB Entry: 2fj8 (more details), 1.19 Å
SCOPe Domain Sequences for d2fj8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj8a2 g.3.13.1 (A:4-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} krpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpic r
Timeline for d2fj8a2: