SCOPe 2.04: Domain d2e42b_: 2e42 B:

Lineage for d2e42b_ (2e42 B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)

8. Domain d2e42b_: 2e42 B: [238636]
   automated match to d1h88b_
   protein/DNA complex; mutant

Details for d2e42b_

PDB Entry: 2e42, 1.8 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer v285a mutant bound to a high affinity dna fragment

PDB Compounds: (B:) CCAAT/enhancer-binding protein beta

SCOPe Domain Sequences for d2e42b_:

Sequence; same for both SEQRES and ATOM records:

>d2e42b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
dkhsdeykirrernniaarksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkql

Timeline for d2e42b_:

• d2e42b_ is new in SCOPe 2.04-stable
  
• d2e42b_ appears in SCOPe 2.05
  
• d2e42b_ appears in the current release, SCOPe 2.08