Lineage for d2dx7a2 (2dx7 A:1-115)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2907332Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2907333Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins)
    C-terminal extension is added to the N-terminal domain
  6. 2907334Protein Aspartate racemase [75310] (1 species)
  7. 2907335Species Pyrococcus horikoshii OT3 [TaxId:70601] [159783] (3 PDB entries)
  8. 2907341Domain d2dx7a2: 2dx7 A:1-115 [238634]
    automated match to d1jfla1
    complexed with cit

Details for d2dx7a2

PDB Entry: 2dx7 (more details), 2 Å

PDB Description: crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid
PDB Compounds: (A:) aspartate racemase

SCOPe Domain Sequences for d2dx7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dx7a2 c.78.2.1 (A:1-115) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mktigilggmgplataelfrriviktpakrdqehpkviifnnpqipdrtayilgkgedpr
pqliwtakrleecgadfiimpantahafvedirkaikipiismieetakkvkelg

SCOPe Domain Coordinates for d2dx7a2:

Click to download the PDB-style file with coordinates for d2dx7a2.
(The format of our PDB-style files is described here.)

Timeline for d2dx7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dx7a1