Lineage for d2bocb1 (2boc B:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371303Domain d2bocb1: 2boc B:1-107 [238620]
    Other proteins in same PDB: d2bocb2, d2bocc_
    automated match to d4ma7l1
    complexed with co, t1a, tl

Details for d2bocb1

PDB Entry: 2boc (more details), 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d2bocb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bocb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

SCOPe Domain Coordinates for d2bocb1:

Click to download the PDB-style file with coordinates for d2bocb1.
(The format of our PDB-style files is described here.)

Timeline for d2bocb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bocb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bocc_