![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
![]() | Domain d2bocb1: 2boc B:1-107 [238620] Other proteins in same PDB: d2bocb2, d2bocc_ automated match to d4ma7l1 complexed with co, t1a, tl |
PDB Entry: 2boc (more details), 3.01 Å
SCOPe Domain Sequences for d2bocb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bocb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik
Timeline for d2bocb1: