![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein Nitrogenase iron protein [52661] (3 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52662] (25 PDB entries) |
![]() | Domain d2afim_: 2afi M: [238614] Other proteins in same PDB: d2afia_, d2afib_, d2afic_, d2afid_, d2afii_, d2afij_, d2afik_, d2afil_ automated match to d2afhe_ complexed with adp, ca, cfn, clf, hca, mg, sf4 |
PDB Entry: 2afi (more details), 3.1 Å
SCOPe Domain Sequences for d2afim_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2afim_ c.37.1.10 (M:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} qcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimemaae agtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvf ydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggli cnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyral arkvvdnkllvipnpitmdeleellmef
Timeline for d2afim_: