Lineage for d2afig_ (2afi G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1595958Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1596165Protein Nitrogenase iron protein [52661] (2 species)
  7. 1596166Species Azotobacter vinelandii [TaxId:354] [52662] (20 PDB entries)
  8. 1596211Domain d2afig_: 2afi G: [238612]
    Other proteins in same PDB: d2afia_, d2afib_, d2afic_, d2afid_, d2afii_, d2afij_, d2afik_, d2afil_
    automated match to d2afhe_
    complexed with adp, ca, cfn, clf, hca, mg, sf4

Details for d2afig_

PDB Entry: 2afi (more details), 3.1 Å

PDB Description: crystal structure of mgadp bound av2-av1 complex
PDB Compounds: (G:) nitrogenase iron protein 1

SCOPe Domain Sequences for d2afig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afig_ c.37.1.10 (G:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmde

SCOPe Domain Coordinates for d2afig_:

Click to download the PDB-style file with coordinates for d2afig_.
(The format of our PDB-style files is described here.)

Timeline for d2afig_: