Lineage for d5tswa_ (5tsw A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555454Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 555455Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 555456Family b.22.1.1: TNF-like [49843] (12 proteins)
  6. 555595Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 555596Species Human (Homo sapiens) [TaxId:9606] [49849] (6 PDB entries)
  8. 555599Domain d5tswa_: 5tsw A: [23861]

Details for d5tswa_

PDB Entry: 5tsw (more details), 2.5 Å

PDB Description: high resolution crystal structure of a human tnf-alpha mutant

SCOP Domain Sequences for d5tswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tswa_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens)}
sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
gdrlsaeinrpdyldfaesgqvyfgiial

SCOP Domain Coordinates for d5tswa_:

Click to download the PDB-style file with coordinates for d5tswa_.
(The format of our PDB-style files is described here.)

Timeline for d5tswa_: