Lineage for d1zoyc_ (1zoy C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630065Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2630100Protein Large cytochrome binding protein CybL [254390] (1 species)
  7. 2630101Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries)
  8. 2630102Domain d1zoyc_: 1zoy C: [238606]
    Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyb2, d1zoyd_
    complexed with eph, f3s, fad, fes, hem, sf4, uq1

Details for d1zoyc_

PDB Entry: 1zoy (more details), 2.4 Å

PDB Description: crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
PDB Compounds: (C:) Large cytochrome binding protein

SCOPe Domain Sequences for d1zoyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoyc_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]}
ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall
lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs
gvvvliltvlssvglaam

SCOPe Domain Coordinates for d1zoyc_:

Click to download the PDB-style file with coordinates for d1zoyc_.
(The format of our PDB-style files is described here.)

Timeline for d1zoyc_: