Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Large cytochrome binding protein CybL [254390] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries) |
Domain d1zoyc_: 1zoy C: [238606] Other proteins in same PDB: d1zoya1, d1zoya2, d1zoya3, d1zoyb1, d1zoyb2, d1zoyd_ complexed with eph, f3s, fad, fes, hem, sf4, uq1 |
PDB Entry: 1zoy (more details), 2.4 Å
SCOPe Domain Sequences for d1zoyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoyc_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]} ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs gvvvliltvlssvglaam
Timeline for d1zoyc_: