Lineage for d1zoya3 (1zoy A:446-622)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2308907Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2308908Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 protein domains)
  6. 2308947Protein Succinate dehydogenase [81708] (3 species)
  7. 2308963Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries)
  8. 2308964Domain d1zoya3: 1zoy A:446-622 [238605]
    Other proteins in same PDB: d1zoya1, d1zoya2, d1zoyb1, d1zoyb2, d1zoyc_, d1zoyd_
    complexed with eph, f3s, fad, fes, hem, sf4, uq1

Details for d1zoya3

PDB Entry: 1zoy (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Respiratory Complex II from porcine heart at 2.4 Angstroms
PDB Compounds: (A:) FAD-binding protein

SCOPe Domain Sequences for d1zoya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoya3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq
hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys
kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy

SCOPe Domain Coordinates for d1zoya3:

Click to download the PDB-style file with coordinates for d1zoya3.
(The format of our PDB-style files is described here.)

Timeline for d1zoya3: