SCOPe 2.04: Domain d1yq3d_: 1yq3 D:

Lineage for d1yq3d_ (1yq3 D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein automated matches [254461] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254987] (6 PDB entries)

8. Domain d1yq3d_: 1yq3 D: [238602]
   Other proteins in same PDB: d1yq3b1, d1yq3b2
   automated match to d1zoyd_
   complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq

Details for d1yq3d_

PDB Entry: 1yq3, 2.2 Å

PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone

PDB Compounds: (D:) Succinate dehydrogenase cytochrome B, small subunit

SCOPe Domain Sequences for d1yq3d_:

Sequence; same for both SEQRES and ATOM records:

>d1yq3d_ f.21.2.2 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhg
dtpikvantglyvlsaitftglcyfnyydvgickavamlwsi

Timeline for d1yq3d_:

• d1yq3d_ is new in SCOPe 2.04-stable
  
• d1yq3d_ appears in SCOPe 2.05
  
• d1yq3d_ appears in the current release, SCOPe 2.08