SCOPe 2.04: Domain d1yntc2: 1ynt C:1108-1213

Lineage for d1yntc2 (1ynt C:1108-1213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d1yntc2: 1ynt C:1108-1213 [238600]
   Other proteins in same PDB: d1ynta1, d1yntb1, d1yntc1, d1yntd1, d1ynte_, d1yntf1, d1yntf2, d1yntg1, d1yntg2
   automated match to d2v7ha2
   complexed with cd

Details for d1yntc2

PDB Entry: 1ynt, 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab

PDB Compounds: (C:) 4F11E12 Fab variable light chain region

SCOPe Domain Sequences for d1yntc2:

Sequence; same for both SEQRES and ATOM records:

>d1yntc2 b.1.1.2 (C:1108-1213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1yntc2:

• d1yntc2 is new in SCOPe 2.04-stable
  
• d1yntc2 appears in SCOPe 2.05
  
• d1yntc2 appears in the current release, SCOPe 2.08