Lineage for d1ynta2 (1ynt A:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2354630Domain d1ynta2: 1ynt A:108-213 [238598]
    Other proteins in same PDB: d1ynta1, d1yntb1, d1yntb2, d1yntc1, d1yntd1, d1yntd2, d1ynte_, d1yntf1, d1yntf2, d1yntg1, d1yntg2
    automated match to d2v7ha2
    complexed with cd

Details for d1ynta2

PDB Entry: 1ynt (more details), 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
PDB Compounds: (A:) 4F11E12 Fab variable light chain region

SCOPe Domain Sequences for d1ynta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynta2 b.1.1.2 (A:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d1ynta2:

Click to download the PDB-style file with coordinates for d1ynta2.
(The format of our PDB-style files is described here.)

Timeline for d1ynta2: