Lineage for d1wbbb3 (1wbb B:567-800)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [226067] (7 PDB entries)
  8. Domain d1wbbb3: 1wbb B:567-800 [238592]
    Other proteins in same PDB: d1wbba1, d1wbba3, d1wbba4, d1wbbb1, d1wbbb2
    automated match to d1wb9a2
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbbb3

PDB Entry: 1wbb (more details), 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbbb3:

Sequence, based on SEQRES records: (download)

>d1wbbb3 c.37.1.0 (B:567-800) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1wbbb3 c.37.1.0 (B:567-800) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeig
rgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdti
afmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1wbbb3 are not available.

Timeline for d1wbbb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wbbb1, d1wbbb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1wbba1, d1wbba2, d1wbba3, d1wbba4