SCOPe 2.07: Domain d1wbbb2: 1wbb B:270-566

Lineage for d1wbbb2 (1wbb B:270-566)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
   multihelical; consists of 2 all-alpha subdomains

4. Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families)

5. Family a.113.1.0: automated matches [254202] (1 protein)
   not a true family

6. Protein automated matches [254442] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254939] (3 PDB entries)

8. Domain d1wbbb2: 1wbb B:270-566 [238591]
   Other proteins in same PDB: d1wbba2, d1wbba3, d1wbba4, d1wbbb1, d1wbbb3
   automated match to d1wb9a1
   protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbbb2

PDB Entry: 1wbb, 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbbb2:

Sequence; same for both SEQRES and ATOM records:

>d1wbbb2 a.113.1.0 (B:270-566) automated matches {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

Timeline for d1wbbb2:

• d1wbbb2 first appeared in SCOPe 2.04
  
• d1wbbb2 appears in SCOPe 2.06
  
• d1wbbb2 appears in the current release, SCOPe 2.08