Class a: All alpha proteins [46456] (289 folds) |
Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) |
Family a.113.1.0: automated matches [254202] (1 protein) not a true family |
Protein automated matches [254442] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254939] (3 PDB entries) |
Domain d1wbbb2: 1wbb B:270-566 [238591] Other proteins in same PDB: d1wbba2, d1wbba3, d1wbba4, d1wbbb1, d1wbbb3 automated match to d1wb9a1 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbb (more details), 2.5 Å
SCOPe Domain Sequences for d1wbbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbbb2 a.113.1.0 (B:270-566) automated matches {Escherichia coli [TaxId: 562]} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1wbbb2:
View in 3D Domains from other chains: (mouse over for more information) d1wbba1, d1wbba2, d1wbba3, d1wbba4 |