SCOPe 2.08: Domain d1wbbb1: 1wbb B:117-269

Lineage for d1wbbb1 (1wbb B:117-269)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families)

5. Family c.55.6.0: automated matches [254201] (1 protein)
   not a true family

6. Protein automated matches [254441] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254938] (3 PDB entries)

8. Domain d1wbbb1: 1wbb B:117-269 [238590]
   Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba4, d1wbbb2, d1wbbb3
   automated match to d1wb9a3
   protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbbb1

PDB Entry: 1wbb, 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbbb1:

Sequence; same for both SEQRES and ATOM records:

>d1wbbb1 c.55.6.0 (B:117-269) automated matches {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

Timeline for d1wbbb1:

• d1wbbb1 first appeared in SCOPe 2.04
  
• d1wbbb1 appears in SCOPe 2.07