Lineage for d1c28c_ (1c28 C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226299Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 226300Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 226301Family b.22.1.1: TNF-like [49843] (7 proteins)
  6. 226302Protein 30 kd adipocyte complement-related protein [49846] (1 species)
  7. 226303Species Mouse (Mus musculus) [TaxId:10090] [49847] (1 PDB entry)
  8. 226306Domain d1c28c_: 1c28 C: [23859]

Details for d1c28c_

PDB Entry: 1c28 (more details), 2.1 Å

PDB Description: the crystal structure of a complment-1q family protein suggests an evolutionary link to tumor necrosis factor

SCOP Domain Sequences for d1c28c_:

Sequence, based on SEQRES records: (download)

>d1c28c_ b.22.1.1 (C:) 30 kd adipocyte complement-related protein {Mouse (Mus musculus)}
myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
dvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyadnv
ndstftgfllyhd

Sequence, based on observed residues (ATOM records): (download)

>d1c28c_ b.22.1.1 (C:) 30 kd adipocyte complement-related protein {Mouse (Mus musculus)}
myrsafsvgletrvtvpirftkifynqqnhydgstgkfycnipglyyfsyhitvdvkvsl
fkkdkavlftqasgsvllhlevgdqvwlqndstftgfllyhd

SCOP Domain Coordinates for d1c28c_:

Click to download the PDB-style file with coordinates for d1c28c_.
(The format of our PDB-style files is described here.)

Timeline for d1c28c_: