Lineage for d1c28c_ (1c28 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777174Protein 30 kDa adipocyte complement-related protein [49846] (1 species)
  7. 2777175Species Mouse (Mus musculus) [TaxId:10090] [49847] (2 PDB entries)
  8. 2777184Domain d1c28c_: 1c28 C: [23859]

Details for d1c28c_

PDB Entry: 1c28 (more details), 2.1 Å

PDB Description: the crystal structure of a complment-1q family protein suggests an evolutionary link to tumor necrosis factor
PDB Compounds: (C:) protein (30 kd adipocyte complement-related protein precursor (acrp30))

SCOPe Domain Sequences for d1c28c_:

Sequence, based on SEQRES records: (download)

>d1c28c_ b.22.1.1 (C:) 30 kDa adipocyte complement-related protein {Mouse (Mus musculus) [TaxId: 10090]}
myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
dvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyadnv
ndstftgfllyhd

Sequence, based on observed residues (ATOM records): (download)

>d1c28c_ b.22.1.1 (C:) 30 kDa adipocyte complement-related protein {Mouse (Mus musculus) [TaxId: 10090]}
myrsafsvgletrvtvpirftkifynqqnhydgstgkfycnipglyyfsyhitvdvkvsl
fkkdkavlftqasgsvllhlevgdqvwlqndstftgfllyhd

SCOPe Domain Coordinates for d1c28c_:

Click to download the PDB-style file with coordinates for d1c28c_.
(The format of our PDB-style files is described here.)

Timeline for d1c28c_: