Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.38: PTS IIb component [52727] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156 |
Superfamily c.38.1: PTS IIb component [52728] (2 families) |
Family c.38.1.0: automated matches [191563] (1 protein) not a true family |
Protein automated matches [190977] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [254924] (4 PDB entries) |
Domain d1vsqc_: 1vsq C: [238589] Other proteins in same PDB: d1vsqa_, d1vsqb_ automated match to d1nrza_ |
PDB Entry: 1vsq (more details)
SCOPe Domain Sequences for d1vsqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsqc_ c.38.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} ndymviglariddrlihgqvatrwtketnvsriivvsdevaadtvrktlltqvappgvta hvvdvakmirvynnpkyagervmllftnptdverlveggvkitsvnvggmafrqgktqvn navsvdekdieafkklnargielevrkvstdpklkmmdliskidk
Timeline for d1vsqc_: