Lineage for d1tzoi2 (1tzo I:174-225)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565881Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1565882Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1565883Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 1565894Protein PA14 [254334] (1 species)
  7. 1565895Species Bacillus anthracis [254763] (14 PDB entries)
  8. 1565917Domain d1tzoi2: 1tzo I:174-225 [238577]
    Other proteins in same PDB: d1tzoa1, d1tzob1, d1tzoc1, d1tzod1, d1tzoe1, d1tzof1, d1tzog1, d1tzoh1, d1tzoi1, d1tzoj1, d1tzok1, d1tzol1, d1tzom1, d1tzoo1
    fragment
    complexed with ca

Details for d1tzoi2

PDB Entry: 1tzo (more details), 3.6 Å

PDB Description: Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore
PDB Compounds: (I:) Protective antigen

SCOPe Domain Sequences for d1tzoi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzoi2 b.179.1.1 (I:174-225) PA14 {Bacillus anthracis}
tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspek

SCOPe Domain Coordinates for d1tzoi2:

Click to download the PDB-style file with coordinates for d1tzoi2.
(The format of our PDB-style files is described here.)

Timeline for d1tzoi2:

1565917
d1tzoi2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1tzoi1