Class b: All beta proteins [48724] (177 folds) |
Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
Superfamily b.179.1: PA14-like [254123] (3 families) |
Family b.179.1.1: PA14 [254147] (2 proteins) Pfam PF07691 |
Protein PA14 [254334] (1 species) |
Species Bacillus anthracis [254763] (15 PDB entries) |
Domain d1tzog2: 1tzo G:174-225 [238573] Other proteins in same PDB: d1tzoa1, d1tzob1, d1tzoc1, d1tzod1, d1tzoe1, d1tzof1, d1tzog1, d1tzoh1, d1tzoi1, d1tzoj1, d1tzok1, d1tzol1, d1tzom1, d1tzoo1 fragment complexed with ca |
PDB Entry: 1tzo (more details), 3.6 Å
SCOPe Domain Sequences for d1tzog2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzog2 b.179.1.1 (G:174-225) PA14 {Bacillus anthracis} tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspek
Timeline for d1tzog2:
View in 3D Domains from other chains: (mouse over for more information) d1tzoa1, d1tzoa2, d1tzob1, d1tzob2, d1tzoc1, d1tzoc2, d1tzod1, d1tzod2, d1tzoe1, d1tzoe2, d1tzof1, d1tzof2, d1tzoh1, d1tzoh2, d1tzoi1, d1tzoi2, d1tzoj1, d1tzoj2, d1tzok1, d1tzok2, d1tzol1, d1tzol2, d1tzom1, d1tzom2, d1tzoo1, d1tzoo2 |