Lineage for d1tzoa2 (1tzo A:174-225)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1815211Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1815212Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1815213Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 1815224Protein PA14 [254334] (1 species)
  7. 1815225Species Bacillus anthracis [254763] (15 PDB entries)
  8. 1815240Domain d1tzoa2: 1tzo A:174-225 [238561]
    Other proteins in same PDB: d1tzoa1, d1tzob1, d1tzoc1, d1tzod1, d1tzoe1, d1tzof1, d1tzog1, d1tzoh1, d1tzoi1, d1tzoj1, d1tzok1, d1tzol1, d1tzom1, d1tzoo1
    fragment
    complexed with ca

Details for d1tzoa2

PDB Entry: 1tzo (more details), 3.6 Å

PDB Description: Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d1tzoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzoa2 b.179.1.1 (A:174-225) PA14 {Bacillus anthracis}
tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspek

SCOPe Domain Coordinates for d1tzoa2:

Click to download the PDB-style file with coordinates for d1tzoa2.
(The format of our PDB-style files is described here.)

Timeline for d1tzoa2: