Lineage for d1alya_ (1aly A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048869Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 2048870Species Human (Homo sapiens) [TaxId:9606] [49845] (2 PDB entries)
  8. 2048871Domain d1alya_: 1aly A: [23856]

Details for d1alya_

PDB Entry: 1aly (more details), 2 Å

PDB Description: crystal structure of human cd40 ligand
PDB Compounds: (A:) cd40 ligand

SCOPe Domain Sequences for d1alya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alya_ b.22.1.1 (A:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]}
gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
svfvnvtdpsqvshgtgftsfgllkl

SCOPe Domain Coordinates for d1alya_:

Click to download the PDB-style file with coordinates for d1alya_.
(The format of our PDB-style files is described here.)

Timeline for d1alya_: