Lineage for d1aly__ (1aly -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459440Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 459441Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 459442Family b.22.1.1: TNF-like [49843] (11 proteins)
  6. 459504Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 459505Species Human (Homo sapiens) [TaxId:9606] [49845] (2 PDB entries)
  8. 459506Domain d1aly__: 1aly - [23856]

Details for d1aly__

PDB Entry: 1aly (more details), 2 Å

PDB Description: crystal structure of human cd40 ligand

SCOP Domain Sequences for d1aly__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aly__ b.22.1.1 (-) Extracellular domain of CD40 ligand {Human (Homo sapiens)}
gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
svfvnvtdpsqvshgtgftsfgllkl

SCOP Domain Coordinates for d1aly__:

Click to download the PDB-style file with coordinates for d1aly__.
(The format of our PDB-style files is described here.)

Timeline for d1aly__: