Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) |
Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
Protein automated matches [192457] (4 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries) |
Domain d1tx6i2: 1tx6 I:5-64 [238558] Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_ automated match to d1c2aa1 complexed with ca |
PDB Entry: 1tx6 (more details), 2.2 Å
SCOPe Domain Sequences for d1tx6i2:
Sequence, based on SEQRES records: (download)
>d1tx6i2 g.3.13.1 (I:5-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} rpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpicr
>d1tx6i2 g.3.13.1 (I:5-64) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} rpwkccdeavctrsippictcmdevfecckscgpsmgdpsrricqdqyvgdpgpicr
Timeline for d1tx6i2: