SCOPe 2.07: Domain d1teec2: 1tee C:247-393

Lineage for d1teec2 (1tee C:247-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 protein domains)

6. Protein Polyketide synthase PKS18 [110758] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
   Uniprot Q79FQ0

8. Domain d1teec2: 1tee C:247-393 [238555]
   mutant

Details for d1teec2

PDB Entry: 1tee, 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis

PDB Compounds: (C:) pks18

SCOPe Domain Sequences for d1teec2:

Sequence; same for both SEQRES and ATOM records:

>d1teec2 c.95.1.2 (C:247-393) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd
idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa
kaistgvafafgpgvtvegmlfdiirr

Timeline for d1teec2:

• d1teec2 first appeared in SCOPe 2.04
  
• d1teec2 appears in SCOPe 2.06