Lineage for d1teec2 (1tee C:247-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917232Protein Polyketide synthase PKS18, C-terminal domain [419035] (1 species)
  7. 2917233Species Mycobacterium tuberculosis [TaxId:1773] [419519] (2 PDB entries)
    Uniprot Q79FQ0
  8. 2917240Domain d1teec2: 1tee C:247-393 [238555]
    Other proteins in same PDB: d1teea1, d1teeb1, d1teec1, d1teed1
    mutant

Details for d1teec2

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: crystal structure of c205f mutant of pks18 from mycobacterium tuberculosis
PDB Compounds: (C:) pks18

SCOPe Domain Sequences for d1teec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teec2 c.95.1.2 (C:247-393) Polyketide synthase PKS18, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd
idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa
kaistgvafafgpgvtvegmlfdiirr

SCOPe Domain Coordinates for d1teec2:

Click to download the PDB-style file with coordinates for d1teec2.
(The format of our PDB-style files is described here.)

Timeline for d1teec2: