| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein Polyketide synthase PKS18, C-terminal domain [419035] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [419519] (2 PDB entries) Uniprot Q79FQ0 |
| Domain d1teec2: 1tee C:247-393 [238555] Other proteins in same PDB: d1teea1, d1teeb1, d1teec1, d1teed1 mutant |
PDB Entry: 1tee (more details), 2.9 Å
SCOPe Domain Sequences for d1teec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teec2 c.95.1.2 (C:247-393) Polyketide synthase PKS18, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd
idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa
kaistgvafafgpgvtvegmlfdiirr
Timeline for d1teec2: