Lineage for d1teec1 (1tee C:22-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2146851Family c.95.1.2: Chalcone synthase-like [53914] (9 protein domains)
  6. 2147069Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 2147070Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
    Uniprot Q79FQ0
  8. 2147083Domain d1teec1: 1tee C:22-246 [238554]
    mutant

Details for d1teec1

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis
PDB Compounds: (C:) pks18

SCOPe Domain Sequences for d1teec1:

Sequence, based on SEQRES records: (download)

>d1teec1 c.95.1.2 (C:22-246) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittr
rmavdpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvla
tstgfiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvc
ielfsvnavfaddindvvihslfgdgcaalvigasqvqeklepgk

Sequence, based on observed residues (ATOM records): (download)

>d1teec1 c.95.1.2 (C:22-246) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
svnavfaddindvvihslfgdgcaalvigasqvqeklepgk

SCOPe Domain Coordinates for d1teec1:

Click to download the PDB-style file with coordinates for d1teec1.
(The format of our PDB-style files is described here.)

Timeline for d1teec1: