Lineage for d1tedd1 (1ted D:31-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917242Protein Polyketide synthase PKS18, N-terminal domain [419034] (1 species)
  7. 2917243Species Mycobacterium tuberculosis [TaxId:1773] [419518] (2 PDB entries)
    Uniprot Q79FQ0
  8. 2917247Domain d1tedd1: 1ted D:31-246 [238548]
    Other proteins in same PDB: d1teda2, d1tedb2, d1tedc2, d1tedd2
    complexed with myr
    has additional insertions and/or extensions that are not grouped together

Details for d1tedd1

PDB Entry: 1ted (more details), 2.25 Å

PDB Description: Crystal structure of a type III polyketide synthase PKS18 from Mycobacterium tuberculosis
PDB Compounds: (D:) pks18

SCOPe Domain Sequences for d1tedd1:

Sequence, based on SEQRES records: (download)

>d1tedd1 c.95.1.2 (D:31-246) Polyketide synthase PKS18, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittrrmavdplda
kfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapg
vdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnav
faddindvvihslfgdgcaalvigasqvqeklepgk

Sequence, based on observed residues (ATOM records): (download)

>d1tedd1 c.95.1.2 (D:31-246) Polyketide synthase PKS18, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnavfadd
indvvihslfgdgcaalvigasqvqeklepgk

SCOPe Domain Coordinates for d1tedd1:

Click to download the PDB-style file with coordinates for d1tedd1.
(The format of our PDB-style files is described here.)

Timeline for d1tedd1: